Lineage for d3m32a2 (3m32 A:270-549)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004845Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 2004846Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 2004847Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (3 proteins)
    C-terminal domain is all-alpha
  6. 2004848Protein Alpha chain [48083] (3 species)
  7. 2004849Species Methanobacterium thermoautotrophicum [TaxId:145262] [48084] (11 PDB entries)
  8. 2004856Domain d3m32a2: 3m32 A:270-549 [199810]
    Other proteins in same PDB: d3m32a1, d3m32b1, d3m32b2, d3m32c_, d3m32d1, d3m32e1, d3m32e2, d3m32f_
    automated match to d1hbna1
    complexed with act, com, edo, f43, mg, peg, sht, tp7, zn

Details for d3m32a2

PDB Entry: 3m32 (more details), 1.35 Å

PDB Description: structural insight into methyl-coenzyme m reductase chemistry using coenzyme b analogues
PDB Compounds: (A:) Methyl-coenzyme M reductase I subunit alpha

SCOPe Domain Sequences for d3m32a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m32a2 a.89.1.1 (A:270-549) Alpha chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
rrargenepggvpfgyladicqssrvnyedpvrvsldvvatgamlydqiwlgsymsggvg
ftqyataaytdnilddftyfgkeyvedkyglceapnnmdtvldvatevtfygleqyeeyp
alledqfggsqraavvaaaagcstafatgnaqtglsgwylsmylhkeqhsrlgfygydlq
dqcgasnvfsirgdeglplelrgpnypnyamnvghqgeyagisqaphaargdafvfnplv
kiafaddnlvfdftnvrgefakgalrefepageralitpa

SCOPe Domain Coordinates for d3m32a2:

Click to download the PDB-style file with coordinates for d3m32a2.
(The format of our PDB-style files is described here.)

Timeline for d3m32a2: