| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) ![]() each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
| Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (3 proteins) C-terminal domain is all-alpha |
| Protein Beta chain [55099] (3 species) |
| Species Methanobacterium thermoautotrophicum [TaxId:145262] [55100] (11 PDB entries) |
| Domain d3m30e1: 3m30 E:2-188 [199807] Other proteins in same PDB: d3m30a1, d3m30a2, d3m30b2, d3m30c_, d3m30d1, d3m30d2, d3m30e2, d3m30f_ automated match to d1hbnb2 complexed with act, com, edo, f43, mg, peg, tp7, xp9, zn |
PDB Entry: 3m30 (more details), 1.45 Å
SCOPe Domain Sequences for d3m30e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m30e1 d.58.31.2 (E:2-188) Beta chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak
vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf
dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi
pqklegp
Timeline for d3m30e1: