Lineage for d3m30a2 (3m30 A:270-549)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1275095Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 1275096Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 1275097Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (2 proteins)
    C-terminal domain is all-alpha
  6. 1275098Protein Alpha chain [48083] (3 species)
  7. 1275099Species Methanobacterium thermoautotrophicum [TaxId:145262] [48084] (11 PDB entries)
  8. 1275110Domain d3m30a2: 3m30 A:270-549 [199802]
    Other proteins in same PDB: d3m30a1, d3m30b1, d3m30b2, d3m30c_, d3m30d1, d3m30e1, d3m30e2, d3m30f_
    automated match to d1hbna1
    complexed with act, com, edo, f43, mg, peg, tp7, xp9, zn

Details for d3m30a2

PDB Entry: 3m30 (more details), 1.45 Å

PDB Description: structural insight into methyl-coenzyme m reductase chemistry using coenzyme b analogues
PDB Compounds: (A:) Methyl-coenzyme M reductase I subunit alpha

SCOPe Domain Sequences for d3m30a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m30a2 a.89.1.1 (A:270-549) Alpha chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
rrargenepggvpfgyladicqssrvnyedpvrvsldvvatgamlydqiwlgsymsggvg
ftqyataaytdnilddftyfgkeyvedkyglceapnnmdtvldvatevtfygleqyeeyp
alledqfggsqraavvaaaagcstafatgnaqtglsgwylsmylhkeqhsrlgfygydlq
dqcgasnvfsirgdeglplelrgpnypnyamnvghqgeyagisqaphaargdafvfnplv
kiafaddnlvfdftnvrgefakgalrefepageralitpa

SCOPe Domain Coordinates for d3m30a2:

Click to download the PDB-style file with coordinates for d3m30a2.
(The format of our PDB-style files is described here.)

Timeline for d3m30a2: