Lineage for d3m2vb2 (3m2v B:189-443)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1741072Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 1741073Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 1741074Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (2 proteins)
    C-terminal domain is all-alpha
  6. 1741105Protein Beta chain [48087] (3 species)
  7. 1741106Species Methanobacterium thermoautotrophicum [TaxId:145262] [48088] (11 PDB entries)
  8. 1741127Domain d3m2vb2: 3m2v B:189-443 [199796]
    Other proteins in same PDB: d3m2va1, d3m2va2, d3m2vb1, d3m2vc_, d3m2vd1, d3m2vd2, d3m2ve1, d3m2vf_
    automated match to d1hbnb1
    complexed with act, com, edo, f43, mg, tp7, xp8, zn

Details for d3m2vb2

PDB Entry: 3m2v (more details), 1.8 Å

PDB Description: structural insight into methyl-coenzyme m reductase chemistry using coenzyme b analogues
PDB Compounds: (B:) Methyl-coenzyme M reductase I subunit beta

SCOPe Domain Sequences for d3m2vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m2vb2 a.89.1.1 (B:189-443) Beta chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
gyalrnimvnhvvaatlkntlqaaalstileqtamfemgdavgafermhllglayqgmna
dnlvfdlvkangkegtvgsviadlveraledgvikvekeltdykvygtddlamwnayaaa
glmaatmvnqgaaraaqgvsstllyyndliefetglpsvdfgkvegtavgfsffshsiyg
gggpgifngnhivtrhskgfaipcvaaamaldagtqmfspeatsglikevfsqvdefrep
lkyvveaaaeiknei

SCOPe Domain Coordinates for d3m2vb2:

Click to download the PDB-style file with coordinates for d3m2vb2.
(The format of our PDB-style files is described here.)

Timeline for d3m2vb2: