SCOPe 2.08: Domain d3m2ud2: 3m2u D:270-549

Lineage for d3m2ud2 (3m2u D:270-549)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
   multihelical bundle; contains buried central helix

4. Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families)

5. Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (3 proteins)
   C-terminal domain is all-alpha

6. Protein Alpha chain [48083] (3 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [48084] (11 PDB entries)

8. Domain d3m2ud2: 3m2u D:270-549 [199790]
   Other proteins in same PDB: d3m2ua1, d3m2ub1, d3m2ub2, d3m2uc_, d3m2ud1, d3m2ue1, d3m2ue2, d3m2uf_
   automated match to d1hbna1
   complexed with act, com, edo, f43, mg, peg, tp7, txz, zn

Details for d3m2ud2

PDB Entry: 3m2u, 1.4 Å

PDB Description: structural insight into methyl-coenzyme m reductase chemistry using coenzyme b analogues

PDB Compounds: (D:) Methyl-coenzyme M reductase I subunit alpha

SCOPe Domain Sequences for d3m2ud2:

Sequence; same for both SEQRES and ATOM records:

>d3m2ud2 a.89.1.1 (D:270-549) Alpha chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
rrargenepggvpfgyladicqssrvnyedpvrvsldvvatgamlydqiwlgsymsggvg
ftqyataaytdnilddftyfgkeyvedkyglceapnnmdtvldvatevtfygleqyeeyp
alledqfggsqraavvaaaagcstafatgnaqtglsgwylsmylhkeqhsrlgfygydlq
dqcgasnvfsirgdeglplelrgpnypnyamnvghqgeyagisqaphaargdafvfnplv
kiafaddnlvfdftnvrgefakgalrefepageralitpa

Timeline for d3m2ud2:

• d3m2ud2 first appeared in SCOPe 2.03
  
• d3m2ud2 appears in SCOPe 2.07