SCOP 1.55: Domain d2jelh1: 2jel H:1-113

Lineage for d2jelh1 (2jel H:1-113)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab JE142 (mouse), kappa L chain [48789] (1 PDB entry)

8. Domain d2jelh1: 2jel H:1-113 [19979]
   Other proteins in same PDB: d2jelh2, d2jell2, d2jelp_

Details for d2jelh1

PDB Entry: 2jel, 2.5 Å

PDB Description: jel42 fab/hpr complex

SCOP Domain Sequences for d2jelh1:

Sequence; same for both SEQRES and ATOM records:

>d2jelh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab JE142 (mouse), kappa L chain}
qvqlaqsgpelvrpgvsvkisckgsgytfttyamhwvkqshakslewiglistysgytny
nqkfkgkatmtvdkssstaymelarltsedsaiyycarvmgeqyfdvwgagttvivss

Timeline for d2jelh1:

• d2jelh1 appears in SCOP 1.57
  
• d2jelh1 appears in the current release, SCOPe 2.08