Lineage for d3m2rb2 (3m2r B:189-443)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719655Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 2719656Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 2719657Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (3 proteins)
    C-terminal domain is all-alpha
  6. 2719688Protein Beta chain [48087] (3 species)
  7. 2719689Species Methanobacterium thermoautotrophicum [TaxId:145262] [48088] (11 PDB entries)
  8. 2719694Domain d3m2rb2: 3m2r B:189-443 [199780]
    Other proteins in same PDB: d3m2ra1, d3m2ra2, d3m2rb1, d3m2rc_, d3m2rd1, d3m2rd2, d3m2re1, d3m2rf_
    automated match to d1hbnb1
    complexed with com, edo, f43, mg, peg, tp7, tpz, zn

Details for d3m2rb2

PDB Entry: 3m2r (more details), 1.3 Å

PDB Description: structural insight into methyl-coenzyme m reductase chemistry using coenzyme b analogues
PDB Compounds: (B:) Methyl-coenzyme M reductase I subunit beta

SCOPe Domain Sequences for d3m2rb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m2rb2 a.89.1.1 (B:189-443) Beta chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
gyalrnimvnhvvaatlkntlqaaalstileqtamfemgdavgafermhllglayqgmna
dnlvfdlvkangkegtvgsviadlveraledgvikvekeltdykvygtddlamwnayaaa
glmaatmvnqgaaraaqgvsstllyyndliefetglpsvdfgkvegtavgfsffshsiyg
gggpgifngnhivtrhskgfaipcvaaamaldagtqmfspeatsglikevfsqvdefrep
lkyvveaaaeiknei

SCOPe Domain Coordinates for d3m2rb2:

Click to download the PDB-style file with coordinates for d3m2rb2.
(The format of our PDB-style files is described here.)

Timeline for d3m2rb2: