SCOP 1.67: Domain d2jell1: 2jel L:1-108

Lineage for d2jell1 (2jel L:1-108)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (121 PDB entries)

8. Domain d2jell1: 2jel L:1-108 [19978]
   Other proteins in same PDB: d2jelh1, d2jelh2, d2jell2, d2jelp_
   part of Fab JE142
   complexed with so4

Details for d2jell1

PDB Entry: 2jel, 2.5 Å

PDB Description: jel42 fab/hpr complex

SCOP Domain Sequences for d2jell1:

Sequence; same for both SEQRES and ATOM records:

>d2jell1 b.1.1.1 (L:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvlmtqtplslpvslgdqasiscrssqsivhgngntylewylqkpgqspklliykisnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikr

Timeline for d2jell1:

• d2jell1 first appeared (with stable ids) in SCOP 1.55
  
• d2jell1 appears in SCOP 1.65
  
• d2jell1 appears in SCOP 1.69
  
• d2jell1 appears in the current release, SCOPe 2.08