Lineage for d3m1ve1 (3m1v E:2-188)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1911012Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 1911046Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)
    C-terminal domain is all-alpha
  6. 1911077Protein Beta chain [55099] (3 species)
  7. 1911078Species Methanobacterium thermoautotrophicum [TaxId:145262] [55100] (11 PDB entries)
  8. 1911092Domain d3m1ve1: 3m1v E:2-188 [199775]
    Other proteins in same PDB: d3m1va1, d3m1va2, d3m1vb2, d3m1vc_, d3m1vd1, d3m1vd2, d3m1ve2, d3m1vf_
    automated match to d1hbnb2
    complexed with act, com, edo, f43, mg, peg, tp7, zn

Details for d3m1ve1

PDB Entry: 3m1v (more details), 1.45 Å

PDB Description: structural insight into methyl-coenzyme m reductase chemistry using coenzyme b analogues
PDB Compounds: (E:) Methyl-coenzyme M reductase I subunit beta

SCOPe Domain Sequences for d3m1ve1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m1ve1 d.58.31.2 (E:2-188) Beta chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak
vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf
dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi
pqklegp

SCOPe Domain Coordinates for d3m1ve1:

Click to download the PDB-style file with coordinates for d3m1ve1.
(The format of our PDB-style files is described here.)

Timeline for d3m1ve1: