SCOPe 2.08: Domain d3m1vb1: 3m1v B:2-188

Lineage for d3m1vb1 (3m1v B:2-188)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families)
   each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures

5. Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (3 proteins)
   C-terminal domain is all-alpha

6. Protein Beta chain [55099] (3 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [55100] (11 PDB entries)

8. Domain d3m1vb1: 3m1v B:2-188 [199771]
   Other proteins in same PDB: d3m1va1, d3m1va2, d3m1vb2, d3m1vc_, d3m1vd1, d3m1vd2, d3m1ve2, d3m1vf_
   automated match to d1hbnb2
   complexed with act, com, edo, f43, mg, peg, tp7, zn

Details for d3m1vb1

PDB Entry: 3m1v, 1.45 Å

PDB Description: structural insight into methyl-coenzyme m reductase chemistry using coenzyme b analogues

PDB Compounds: (B:) Methyl-coenzyme M reductase I subunit beta

SCOPe Domain Sequences for d3m1vb1:

Sequence; same for both SEQRES and ATOM records:

>d3m1vb1 d.58.31.2 (B:2-188) Beta chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak
vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf
dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi
pqklegp

Timeline for d3m1vb1:

• d3m1vb1 first appeared in SCOPe 2.03
  
• d3m1vb1 appears in SCOPe 2.07