SCOPe 2.01: Domain d3hfmh1: 3hfm H:1-113

Lineage for d3hfmh1 (3hfm H:1-113)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (31 PDB entries)

8. Domain d3hfmh1: 3hfm H:1-113 [19977]
   Other proteins in same PDB: d3hfmh2, d3hfml1, d3hfml2, d3hfmy_
   part of Fab HyHEL-10

Details for d3hfmh1

PDB Entry: 3hfm, 3 Å

PDB Description: structure of an antibody-antigen complex. crystal structure of the hy/hel-10 fab-lysozyme complex

PDB Compounds: (H:) hyhel-10 igg1 fab (heavy chain)

SCOPe Domain Sequences for d3hfmh1:

Sequence; same for both SEQRES and ATOM records:

>d3hfmh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvsysgstyyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsa

Timeline for d3hfmh1:

• d3hfmh1 first appeared (with stable ids) in SCOP 1.55
  
• d3hfmh1 appears in SCOP 1.75
  
• d3hfmh1 appears in SCOPe 2.02
  
• d3hfmh1 appears in the current release, SCOPe 2.08