Lineage for d3hfmh1 (3hfm H:1-113)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158221Species Fab HyHEL-10 (mouse), kappa L chain [48788] (5 PDB entries)
  8. 158230Domain d3hfmh1: 3hfm H:1-113 [19977]
    Other proteins in same PDB: d3hfmh2, d3hfml2, d3hfmy_

Details for d3hfmh1

PDB Entry: 3hfm (more details), 3 Å

PDB Description: structure of an antibody-antigen complex. crystal structure of the hy/hel-10 fab-lysozyme complex

SCOP Domain Sequences for d3hfmh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hfmh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab HyHEL-10 (mouse), kappa L chain}
dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvsysgstyyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsa

SCOP Domain Coordinates for d3hfmh1:

Click to download the PDB-style file with coordinates for d3hfmh1.
(The format of our PDB-style files is described here.)

Timeline for d3hfmh1: