Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins) C-terminal domain is all-alpha |
Protein Alpha chain [55095] (3 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [55096] (11 PDB entries) |
Domain d3m1va1: 3m1v A:2-269 [199769] Other proteins in same PDB: d3m1va2, d3m1vb1, d3m1vb2, d3m1vc_, d3m1vd2, d3m1ve1, d3m1ve2, d3m1vf_ automated match to d1hbna2 complexed with act, com, edo, f43, mg, peg, tp7, zn |
PDB Entry: 3m1v (more details), 1.45 Å
SCOPe Domain Sequences for d3m1va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m1va1 d.58.31.2 (A:2-269) Alpha chain {Methanobacterium thermoautotrophicum [TaxId: 145262]} adklfinalkkkfeespeekkttfytlggwkqserktefvnagkevaakrgipqynpdig tplgqrvlmpyqvsttdtyvegddlhfvnnaamqqmwddirrtvivglnhahaviekrlg kevtpetithyletvnhampgaavvqehmvethpalvadsyvkvftgndeiadeidpafv idinkqfpedqaetlkaevgdgiwqvvriptivsrtcdgattsrwsamqigmsmisaykq aageaatgdfayaakhaevihmgtylpv
Timeline for d3m1va1: