Lineage for d3m1pa_ (3m1p A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2169121Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 2169122Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 2169174Family c.121.1.0: automated matches [191649] (1 protein)
    not a true family
  6. 2169175Protein automated matches [191196] (8 species)
    not a true protein
  7. 2169225Species Trypanosoma cruzi [TaxId:5693] [193715] (1 PDB entry)
  8. 2169226Domain d3m1pa_: 3m1p A: [199768]
    automated match to d3m1pb_
    complexed with po4

Details for d3m1pa_

PDB Entry: 3m1p (more details), 2.2 Å

PDB Description: Structure of ribose 5-phosphate isomerase type B from Trypanosoma cruzi, soaked with allose-6-phosphate
PDB Compounds: (A:) Ribose 5-phosphate isomerase

SCOPe Domain Sequences for d3m1pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m1pa_ c.121.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
mtrrvaigtdhpafaihenlilyvkeagdefvpvycgpktaesvdypdfasrvaemvark
evefgvlaagsgigmsiaankvpgvraalchdhytaamsrihndanivcvgerttgvevi
reiiitflqtpfsgeerhvrriekiraieasha

SCOPe Domain Coordinates for d3m1pa_:

Click to download the PDB-style file with coordinates for d3m1pa_.
(The format of our PDB-style files is described here.)

Timeline for d3m1pa_: