![]() | Class g: Small proteins [56992] (92 folds) |
![]() | Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
![]() | Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
![]() | Family g.44.1.0: automated matches [191345] (1 protein) not a true family |
![]() | Protein automated matches [190242] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189860] (5 PDB entries) |
![]() | Domain d3lrqc_: 3lrq C: [199763] automated match to d3lrqd_ complexed with zn |
PDB Entry: 3lrq (more details), 2.29 Å
SCOPe Domain Sequences for d3lrqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lrqc_ g.44.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mdeqsvesiaevfrcficmeklrdarlcphcsklccfscirrwlteqraqcphcraplql relvncrwaeevtqqldtlqlc
Timeline for d3lrqc_: