SCOPe 2.05: Domain d3lrqc_: 3lrq C:

Lineage for d3lrqc_ (3lrq C:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.0: automated matches [191345] (1 protein)
   not a true family

6. Protein automated matches [190242] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189860] (5 PDB entries)

8. Domain d3lrqc_: 3lrq C: [199763]
   automated match to d3lrqd_
   complexed with zn

Details for d3lrqc_

PDB Entry: 3lrq, 2.29 Å

PDB Description: crystal structure of the u-box domain of human ubiquitin-protein ligase (e3), northeast structural genomics consortium target hr4604d.

PDB Compounds: (C:) E3 ubiquitin-protein ligase TRIM37

SCOPe Domain Sequences for d3lrqc_:

Sequence; same for both SEQRES and ATOM records:

>d3lrqc_ g.44.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdeqsvesiaevfrcficmeklrdarlcphcsklccfscirrwlteqraqcphcraplql
relvncrwaeevtqqldtlqlc

Timeline for d3lrqc_:

• d3lrqc_ first appeared in SCOPe 2.03
  
• d3lrqc_ appears in SCOPe 2.04
  
• d3lrqc_ appears in SCOPe 2.06
  
• d3lrqc_ appears in the current release, SCOPe 2.08