Lineage for d3lrqb1 (3lrq B:1-79)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642222Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 2642223Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 2642377Family g.44.1.0: automated matches [191345] (1 protein)
    not a true family
  6. 2642378Protein automated matches [190242] (4 species)
    not a true protein
  7. 2642383Species Human (Homo sapiens) [TaxId:9606] [189860] (11 PDB entries)
  8. 2642388Domain d3lrqb1: 3lrq B:1-79 [199762]
    Other proteins in same PDB: d3lrqa2, d3lrqb2
    automated match to d3lrqd_
    complexed with zn

Details for d3lrqb1

PDB Entry: 3lrq (more details), 2.29 Å

PDB Description: crystal structure of the u-box domain of human ubiquitin-protein ligase (e3), northeast structural genomics consortium target hr4604d.
PDB Compounds: (B:) E3 ubiquitin-protein ligase TRIM37

SCOPe Domain Sequences for d3lrqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lrqb1 g.44.1.0 (B:1-79) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdeqsvesiaevfrcficmeklrdarlcphcsklccfscirrwlteqraqcphcraplql
relvncrwaeevtqqldtl

SCOPe Domain Coordinates for d3lrqb1:

Click to download the PDB-style file with coordinates for d3lrqb1.
(The format of our PDB-style files is described here.)

Timeline for d3lrqb1: