![]() | Class g: Small proteins [56992] (94 folds) |
![]() | Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
![]() | Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
![]() | Family g.44.1.0: automated matches [191345] (1 protein) not a true family |
![]() | Protein automated matches [190242] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189860] (5 PDB entries) |
![]() | Domain d3lrqa1: 3lrq A:1-81 [199761] Other proteins in same PDB: d3lrqa2, d3lrqb2 automated match to d3lrqd_ complexed with zn |
PDB Entry: 3lrq (more details), 2.29 Å
SCOPe Domain Sequences for d3lrqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lrqa1 g.44.1.0 (A:1-81) automated matches {Human (Homo sapiens) [TaxId: 9606]} mdeqsvesiaevfrcficmeklrdarlcphcsklccfscirrwlteqraqcphcraplql relvncrwaeevtqqldtlql
Timeline for d3lrqa1:
![]() Domains from other chains: (mouse over for more information) d3lrqb1, d3lrqb2, d3lrqc_, d3lrqd_ |