SCOPe 2.08: Domain d3lrqa1: 3lrq A:1-81

Lineage for d3lrqa1 (3lrq A:1-81)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.0: automated matches [191345] (1 protein)
   not a true family

6. Protein automated matches [190242] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189860] (17 PDB entries)

8. Domain d3lrqa1: 3lrq A:1-81 [199761]
   Other proteins in same PDB: d3lrqa2, d3lrqb2
   automated match to d3lrqd_
   complexed with zn

Details for d3lrqa1

PDB Entry: 3lrq, 2.29 Å

PDB Description: crystal structure of the u-box domain of human ubiquitin-protein ligase (e3), northeast structural genomics consortium target hr4604d.

PDB Compounds: (A:) E3 ubiquitin-protein ligase TRIM37

SCOPe Domain Sequences for d3lrqa1:

Sequence; same for both SEQRES and ATOM records:

>d3lrqa1 g.44.1.0 (A:1-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdeqsvesiaevfrcficmeklrdarlcphcsklccfscirrwlteqraqcphcraplql
relvncrwaeevtqqldtlql

Timeline for d3lrqa1:

• d3lrqa1 first appeared in SCOPe 2.03, called d3lrqa_
  
• d3lrqa1 appears in SCOPe 2.07