Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (18 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries) |
Domain d3lrga_: 3lrg A: [199760] automated match to d3lrho_ complexed with imd, trs |
PDB Entry: 3lrg (more details), 2.05 Å
SCOPe Domain Sequences for d3lrga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lrga_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sqpvltqspsvsaaprqrvtisvsgsnsnigsntvnwiqqlpgrapellmydddllapgv sdrfsgsrsgtsasltisglqsedeadyyaatwddslngwvfgggtkvtvlsah
Timeline for d3lrga_: