SCOP 1.63: Domain d3hfml1: 3hfm L:1-108

Lineage for d3hfml1 (3hfm L:1-108)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab HyHEL-10 (mouse), kappa L chain [48788] (8 PDB entries)

8. Domain d3hfml1: 3hfm L:1-108 [19976]
   Other proteins in same PDB: d3hfmh2, d3hfml2, d3hfmy_

Details for d3hfml1

PDB Entry: 3hfm, 3 Å

PDB Description: structure of an antibody-antigen complex. crystal structure of the hy/hel-10 fab-lysozyme complex

SCOP Domain Sequences for d3hfml1:

Sequence; same for both SEQRES and ATOM records:

>d3hfml1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab HyHEL-10 (mouse), kappa L chain}
divltqspatlsvtpgnsvslscrasqsignnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleikr

Timeline for d3hfml1:

• d3hfml1 first appeared (with stable ids) in SCOP 1.55
  
• d3hfml1 appears in SCOP 1.61
  
• d3hfml1 appears in SCOP 1.65
  
• d3hfml1 appears in the current release, SCOPe 2.08