SCOPe 2.05: Domain d3lp1a2: 3lp1 A:430-557

Lineage for d3lp1a2 (3lp1 A:430-557)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (30 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11706] [225515] (19 PDB entries)

8. Domain d3lp1a2: 3lp1 A:430-557 [199757]
   Other proteins in same PDB: d3lp1a1, d3lp1b_
   automated match to d1bqna1
   protein/DNA complex; protein/RNA complex; complexed with lp8, mn, nvp

Details for d3lp1a2

PDB Entry: 3lp1, 2.23 Å

PDB Description: hiv-1 reverse transcriptase with inhibitor

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d3lp1a2:

Sequence; same for both SEQRES and ATOM records:

>d3lp1a2 c.55.3.0 (A:430-557) automated matches {Human immunodeficiency virus type 1 [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagir

Timeline for d3lp1a2:

• d3lp1a2 first appeared in SCOPe 2.03
  
• d3lp1a2 appears in SCOPe 2.04
  
• d3lp1a2 appears in SCOPe 2.06
  
• d3lp1a2 appears in the current release, SCOPe 2.08