Lineage for d3loob_ (3loo B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904617Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2904618Protein automated matches [190117] (50 species)
    not a true protein
  7. 2904619Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [196378] (1 PDB entry)
  8. 2904621Domain d3loob_: 3loo B: [199753]
    automated match to d3looc_
    complexed with b4p, cl, mg

Details for d3loob_

PDB Entry: 3loo (more details), 2 Å

PDB Description: Crystal structure of Anopheles gambiae adenosine kinase in complex with P1,P4-di(adenosine-5) tetraphosphate
PDB Compounds: (B:) Anopheles gambiae adenosine kinase

SCOPe Domain Sequences for d3loob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3loob_ c.72.1.0 (B:) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
lrdgmlvglgnplldisavvekdllnkydmqpnnailaeekhmpmyqeliekyqaeyiag
gsvqnslrvaqwilqrprtaiffgcvgqdeyarileeratsngvnvqyqrsatsptgtca
vlvtgtqrslcanlaaandftpehlrsdgnraylqgaqffyvsgffftvsfesalsvake
aaatgrmfmmnlsapfvpqfyknnleeifpyvdvlfgneteaialakefnygtedlreig
kriaalpkengkrkriviitqgsdpvllieagtdnvrefpvqklapeqmvdtngagdafv
ggflaqllqsrtvdvcikcgiwaareiiqrsgctfegepsf

SCOPe Domain Coordinates for d3loob_:

Click to download the PDB-style file with coordinates for d3loob_.
(The format of our PDB-style files is described here.)

Timeline for d3loob_: