| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
| Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
| Protein automated matches [190117] (50 species) not a true protein |
| Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [196378] (1 PDB entry) |
| Domain d3loob_: 3loo B: [199753] automated match to d3looc_ complexed with b4p, cl, mg |
PDB Entry: 3loo (more details), 2 Å
SCOPe Domain Sequences for d3loob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3loob_ c.72.1.0 (B:) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
lrdgmlvglgnplldisavvekdllnkydmqpnnailaeekhmpmyqeliekyqaeyiag
gsvqnslrvaqwilqrprtaiffgcvgqdeyarileeratsngvnvqyqrsatsptgtca
vlvtgtqrslcanlaaandftpehlrsdgnraylqgaqffyvsgffftvsfesalsvake
aaatgrmfmmnlsapfvpqfyknnleeifpyvdvlfgneteaialakefnygtedlreig
kriaalpkengkrkriviitqgsdpvllieagtdnvrefpvqklapeqmvdtngagdafv
ggflaqllqsrtvdvcikcgiwaareiiqrsgctfegepsf
Timeline for d3loob_: