![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
![]() | Species Human (Homo sapiens), HLA-B35 [TaxId:9606] [54475] (13 PDB entries) Uniprot P30685 25-300 |
![]() | Domain d3lksa1: 3lks A:1-181 [199745] Other proteins in same PDB: d3lksa2, d3lksb1, d3lksb2 automated match to d1xh3a2 |
PDB Entry: 3lks (more details), 1.9 Å
SCOPe Domain Sequences for d3lksa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lksa1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B35 [TaxId: 9606]} gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq r
Timeline for d3lksa1: