SCOP 1.65: Domain d1c08a_: 1c08 A:

Lineage for d1c08a_ (1c08 A:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (146 PDB entries)

8. Domain d1c08a_: 1c08 A: [19974]
   Other proteins in same PDB: d1c08b_, d1c08c_
   part of Fv HyHEL-10

Details for d1c08a_

PDB Entry: 1c08, 2.3 Å

PDB Description: crystal structure of hyhel-10 fv-hen lysozyme complex

SCOP Domain Sequences for d1c08a_:

Sequence; same for both SEQRES and ATOM records:

>d1c08a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
divltqspatlsvtpgnsvslscrasqsignnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik

Timeline for d1c08a_:

• d1c08a_ first appeared (with stable ids) in SCOP 1.55
  
• d1c08a_ appears in SCOP 1.63
  
• d1c08a_ appears in SCOP 1.67
  
• d1c08a_ appears in the current release, SCOPe 2.08