![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species Fab HyHEL-10 (mouse), kappa L chain [48788] (2 PDB entries) |
![]() | Domain d1c08a_: 1c08 A: [19974] Other proteins in same PDB: d1c08c_ |
PDB Entry: 1c08 (more details), 2.3 Å
SCOP Domain Sequences for d1c08a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c08a_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Fab HyHEL-10 (mouse), kappa L chain} divltqspatlsvtpgnsvslscrasqsignnlhwyqqkshesprllikyasqsisgips rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik
Timeline for d1c08a_: