SCOPe 2.03: Domain d3ljwa_: 3ljw A:

Lineage for d3ljwa_ (3ljw A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (145 PDB entries)

8. Domain d3ljwa_: 3ljw A: [199731]
   automated match to d3ljwb_
   complexed with act, na

Details for d3ljwa_

PDB Entry: 3ljw, 1.5 Å

PDB Description: crystal structure of the second bromodomain of human polybromo

PDB Compounds: (A:) Protein polybromo-1

SCOPe Domain Sequences for d3ljwa_:

Sequence; same for both SEQRES and ATOM records:

>d3ljwa_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsspaylkeileqlleaivvatnpsgrliselfqklpskvqypdyyaiikepidlktiaq
riqngsyksihamakdidllaknaktynepgsqvfkdansikkifymkkaeiehhema

Timeline for d3ljwa_:

• d3ljwa_ is new in SCOPe 2.03-stable
  
• d3ljwa_ appears in SCOPe 2.04
  
• d3ljwa_ appears in the current release, SCOPe 2.08