Lineage for d3lizl1 (3liz L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759607Domain d3lizl1: 3liz L:1-107 [199729]
    Other proteins in same PDB: d3liza1, d3liza2, d3lizl2
    automated match to d1eo8l1
    complexed with cd, edo, nag, zn

Details for d3lizl1

PDB Entry: 3liz (more details), 1.8 Å

PDB Description: crystal structure of bla g 2 complexed with fab 4c3
PDB Compounds: (L:) 4C3 monoclonal antibody Light Chain

SCOPe Domain Sequences for d3lizl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lizl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qivltqspssmyaslgervtitckasqdinnylswfqqkpgkspktliyradrlvdgvps
rvsgsgsgqdysltissleyedlgiyyclqydelpytfgggtkleik

SCOPe Domain Coordinates for d3lizl1:

Click to download the PDB-style file with coordinates for d3lizl1.
(The format of our PDB-style files is described here.)

Timeline for d3lizl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lizl2