Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (12 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [225911] (1 PDB entry) |
Domain d3l9rg2: 3l9r G:184-278 [199724] Other proteins in same PDB: d3l9ra1, d3l9rb_, d3l9rc1, d3l9rd_, d3l9re1, d3l9rf_, d3l9rg1, d3l9rh_ automated match to d1gzqa1 complexed with cl, gol, l9q, l9r, nag |
PDB Entry: 3l9r (more details), 2.3 Å
SCOPe Domain Sequences for d3l9rg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l9rg2 b.1.1.2 (G:184-278) automated matches {Cow (Bos taurus) [TaxId: 9913]} qvkpeawlssgptpgpgrlllvchvsgfypkpvrvmwmrgeqeqpgtqqgdlmpnadwtw ylrvtlnvaageaaglncrvkhsslgdqdiilywh
Timeline for d3l9rg2: