Lineage for d3l9rg1 (3l9r G:3-183)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938555Protein automated matches [191280] (6 species)
    not a true protein
  7. 2938562Species Cow (Bos taurus) [TaxId:9913] [225910] (2 PDB entries)
  8. 2938567Domain d3l9rg1: 3l9r G:3-183 [199723]
    Other proteins in same PDB: d3l9ra2, d3l9ra3, d3l9rb_, d3l9rc2, d3l9rc3, d3l9rd_, d3l9re2, d3l9re3, d3l9rf_, d3l9rg2, d3l9rg3, d3l9rh_
    automated match to d1gzpa2
    complexed with cl, gol, l9q, l9r, nag

Details for d3l9rg1

PDB Entry: 3l9r (more details), 2.3 Å

PDB Description: crystal structure of bovine cd1b3 with endogenously bound ligands
PDB Compounds: (G:) CD1b3

SCOPe Domain Sequences for d3l9rg1:

Sequence, based on SEQRES records: (download)

>d3l9rg1 d.19.1.1 (G:3-183) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vfqgptsfhlmqistfvnstwaqnqgsgwlddlqihgwesdsgtaiflkpwskgnfsdde
vtelvdlfrayfigftrevqdrvnefqleypfviqvtagcelhsgeaiesslrgalggld
fvsiqnhscvpapdsgsrgqkfcalttqyqgisdiierllsetcpryllgvldagkaelq
r

Sequence, based on observed residues (ATOM records): (download)

>d3l9rg1 d.19.1.1 (G:3-183) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vfqgptsfhlmqistfvnstwaqnqgsgwlddlqihgwesdsgtaiflkpwskgnfsdde
vtelvdlfrayfigftrevqdrvnefqleypfviqvtagcelhsgaiesslrgalggldf
vsiqnhscvpapdsgsrgqkfcalttqyqgisdiierllsetcpryllgvldagkaelqr

SCOPe Domain Coordinates for d3l9rg1:

Click to download the PDB-style file with coordinates for d3l9rg1.
(The format of our PDB-style files is described here.)

Timeline for d3l9rg1: