SCOPe 2.01: Domain d2iffl1: 2iff L:1-106

Lineage for d2iffl1 (2iff L:1-106)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (44 PDB entries)
   Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1

8. Domain d2iffl1: 2iff L:1-106 [19972]
   Other proteins in same PDB: d2iffh1, d2iffh2, d2iffl2, d2iffy_
   part of Fab HyHEL-5
   mutant

Details for d2iffl1

PDB Entry: 2iff, 2.65 Å

PDB Description: structure of an antibody-lysozyme complex: effect of a conservative mutation

PDB Compounds: (L:) igg1 hyhel-5 fab (light chain)

SCOPe Domain Sequences for d2iffl1:

Sequence; same for both SEQRES and ATOM records:

>d2iffl1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
divltqspaimsaspgekvtmtcsasssvnymywyqqksgtspkrwiydtsklasgvpvr
fsgsgsgtsysltissmetedaatyycqqwgrnptfgggtkleikr

Timeline for d2iffl1:

• d2iffl1 first appeared (with stable ids) in SCOP 1.55
  
• d2iffl1 appears in SCOP 1.75
  
• d2iffl1 appears in SCOPe 2.02
  
• d2iffl1 appears in the current release, SCOPe 2.08