Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) |
Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins) a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [81644] (8 PDB entries) |
Domain d3l75c2: 3l75 C:262-380 [199714] Other proteins in same PDB: d3l75a1, d3l75a2, d3l75b1, d3l75b2, d3l75c1, d3l75d1, d3l75d2, d3l75e1, d3l75e2, d3l75f_, d3l75g_, d3l75h_, d3l75j_, d3l75n1, d3l75n2, d3l75o1, d3l75o2, d3l75p1, d3l75q1, d3l75q2, d3l75r1, d3l75r2, d3l75s_, d3l75t_, d3l75u_, d3l75w_ automated match to d1bccc2 complexed with azi, bog, cdl, fes, fnm, hec, hem, pee, unl, uq |
PDB Entry: 3l75 (more details), 2.79 Å
SCOPe Domain Sequences for d3l75c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l75c2 f.32.1.1 (C:262-380) Mitochondrial cytochrome b subunit, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} plvtpphikpewyflfayailrsipnklggvlalaasvlilflipflhkskqrtmtfrpl sqtlfwllvanlliltwigsqpvehpfiiigqmaslsyftillilfptigtlenkmlny
Timeline for d3l75c2:
View in 3D Domains from other chains: (mouse over for more information) d3l75a1, d3l75a2, d3l75b1, d3l75b2, d3l75d1, d3l75d2, d3l75e1, d3l75e2, d3l75f_, d3l75g_, d3l75h_, d3l75j_, d3l75n1, d3l75n2, d3l75o1, d3l75o2, d3l75p1, d3l75p2, d3l75q1, d3l75q2, d3l75r1, d3l75r2, d3l75s_, d3l75t_, d3l75u_, d3l75w_ |