SCOP 1.65: Domain d1bqlh1: 1bql H:2-116

Lineage for d1bqlh1 (1bql H:2-116)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (118 PDB entries)

8. Domain d1bqlh1: 1bql H:2-116 [19971]
   Other proteins in same PDB: d1bqlh2, d1bqll1, d1bqll2, d1bqly_
   part of Fab HyHEL-5

Details for d1bqlh1

PDB Entry: 1bql, 2.6 Å

PDB Description: structure of an anti-hel fab fragment complexed with bobwhite quail lysozyme

SCOP Domain Sequences for d1bqlh1:

Sequence; same for both SEQRES and ATOM records:

>d1bqlh1 b.1.1.1 (H:2-116) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
vqlqqsgaelmkpgasvkisckasgytfsdywiewvkqrpghglewigeilpgsgstnyh
erfkgkatftadtssstaymqlnsltsedsgvyyclhgnydfdgwgqgttltvss

Timeline for d1bqlh1:

• d1bqlh1 first appeared (with stable ids) in SCOP 1.55
  
• d1bqlh1 appears in SCOP 1.63
  
• d1bqlh1 appears in SCOP 1.67
  
• d1bqlh1 appears in the current release, SCOPe 2.08