SCOP 1.63: Domain d1bqlh1: 1bql H:2-116

Lineage for d1bqlh1 (1bql H:2-116)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab HyHEL-5 (mouse), kappa L chain [48787] (3 PDB entries)

8. Domain d1bqlh1: 1bql H:2-116 [19971]
   Other proteins in same PDB: d1bqlh2, d1bqll2, d1bqly_

Details for d1bqlh1

PDB Entry: 1bql, 2.6 Å

PDB Description: structure of an anti-hel fab fragment complexed with bobwhite quail lysozyme

SCOP Domain Sequences for d1bqlh1:

Sequence; same for both SEQRES and ATOM records:

>d1bqlh1 b.1.1.1 (H:2-116) Immunoglobulin (variable domains of L and H chains) {Fab HyHEL-5 (mouse), kappa L chain}
vqlqqsgaelmkpgasvkisckasgytfsdywiewvkqrpghglewigeilpgsgstnyh
erfkgkatftadtssstaymqlnsltsedsgvyyclhgnydfdgwgqgttltvss

Timeline for d1bqlh1:

• d1bqlh1 first appeared (with stable ids) in SCOP 1.55
  
• d1bqlh1 appears in SCOP 1.61
  
• d1bqlh1 appears in SCOP 1.65
  
• d1bqlh1 appears in the current release, SCOPe 2.08