Lineage for d1bqlh1 (1bql H:2-116)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219804Species Fab HyHEL-5 (mouse), kappa L chain [48787] (3 PDB entries)
  8. 219805Domain d1bqlh1: 1bql H:2-116 [19971]
    Other proteins in same PDB: d1bqlh2, d1bqll2, d1bqly_

Details for d1bqlh1

PDB Entry: 1bql (more details), 2.6 Å

PDB Description: structure of an anti-hel fab fragment complexed with bobwhite quail lysozyme
PDB Compounds: (H:)

SCOP Domain Sequences for d1bqlh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqlh1 b.1.1.1 (H:2-116) Immunoglobulin (variable domains of L and H chains) {Fab HyHEL-5 (mouse), kappa L chain}
vqlqqsgaelmkpgasvkisckasgytfsdywiewvkqrpghglewigeilpgsgstnyh
erfkgkatftadtssstaymqlnsltsedsgvyyclhgnydfdgwgqgttltvss

SCOP Domain Coordinates for d1bqlh1:

Click to download the PDB-style file with coordinates for d1bqlh1.
(The format of our PDB-style files is described here.)

Timeline for d1bqlh1: