Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Fab HyHEL-5 (mouse), kappa L chain [48787] (3 PDB entries) |
Domain d1bqlh1: 1bql H:2-116 [19971] Other proteins in same PDB: d1bqlh2, d1bqll2, d1bqly_ |
PDB Entry: 1bql (more details), 2.6 Å
SCOP Domain Sequences for d1bqlh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bqlh1 b.1.1.1 (H:2-116) Immunoglobulin (variable domains of L and H chains) {Fab HyHEL-5 (mouse), kappa L chain} vqlqqsgaelmkpgasvkisckasgytfsdywiewvkqrpghglewigeilpgsgstnyh erfkgkatftadtssstaymqlnsltsedsgvyyclhgnydfdgwgqgttltvss
Timeline for d1bqlh1: