Lineage for d3l70c1 (3l70 C:1-261)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697409Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 1697410Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 1697416Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 1697427Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
    also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits
  7. 1697435Species Chicken (Gallus gallus) [TaxId:9031] [81639] (8 PDB entries)
  8. 1697442Domain d3l70c1: 3l70 C:1-261 [199701]
    Other proteins in same PDB: d3l70a1, d3l70a2, d3l70b1, d3l70b2, d3l70c2, d3l70d1, d3l70d2, d3l70f_, d3l70g_, d3l70h_, d3l70j_, d3l70n1, d3l70o1, d3l70o2, d3l70p2, d3l70q1, d3l70q2, d3l70s_, d3l70t_, d3l70u_, d3l70w_
    automated match to d1bccc3
    complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq

Details for d3l70c1

PDB Entry: 3l70 (more details), 2.75 Å

PDB Description: cytochrome bc1 complex from chicken with trifloxystrobin bound
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d3l70c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l70c1 f.21.1.2 (C:1-261) Mitochondrial cytochrome b subunit, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mapnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadt
slafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvil
lltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrff
alhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpf
ltlalfspnllgdpenftpan

SCOPe Domain Coordinates for d3l70c1:

Click to download the PDB-style file with coordinates for d3l70c1.
(The format of our PDB-style files is described here.)

Timeline for d3l70c1: