![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d3l5xl2: 3l5x L:108-214 [199697] Other proteins in same PDB: d3l5xa_, d3l5xh_, d3l5xl1 automated match to d1rhha2 complexed with gol, mes |
PDB Entry: 3l5x (more details), 1.9 Å
SCOPe Domain Sequences for d3l5xl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l5xl2 b.1.1.2 (L:108-214) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d3l5xl2: