![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
![]() | Protein automated matches [190646] (77 species) not a true protein |
![]() | Species Rhodobacter sphaeroides [TaxId:272943] [196489] (1 PDB entry) |
![]() | Domain d3l49c1: 3l49 C:29-309 [199691] Other proteins in same PDB: d3l49a2, d3l49b2, d3l49c2, d3l49d2 automated match to d3l49d_ complexed with unl |
PDB Entry: 3l49 (more details), 2.3 Å
SCOPe Domain Sequences for d3l49c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l49c1 c.93.1.0 (C:29-309) automated matches {Rhodobacter sphaeroides [TaxId: 272943]} legktigitaigtdhdwdlkayqaqiaeierlggtaialdagrndqtqvsqiqtliaqkp daiieqlgnldvlnpwlqkindagiplftvdtatphainnttsnnysigaelalqmvadl ggkgnvlvfngfysvpvckirydqmkyvleafpdvkiiepelrdvipntiqsaysnvtdm ltkypnegdvgaiwacwdvpmigatqalqaagrtdirtygvdgspefvemvadpespaga vaaqqpseigklavqnvarhlagqevkpftfapavlitken
Timeline for d3l49c1: