Lineage for d3hflh1 (3hfl H:1-116)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219804Species Fab HyHEL-5 (mouse), kappa L chain [48787] (3 PDB entries)
  8. 219807Domain d3hflh1: 3hfl H:1-116 [19969]
    Other proteins in same PDB: d3hflh2, d3hfll2, d3hfly_

Details for d3hflh1

PDB Entry: 3hfl (more details), 2.65 Å

PDB Description: the refined structure of the monoclonal antibody hy(slash)hel-5 with its antigen hen egg white lysozyme
PDB Compounds: (H:)

SCOP Domain Sequences for d3hflh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hflh1 b.1.1.1 (H:1-116) Immunoglobulin (variable domains of L and H chains) {Fab HyHEL-5 (mouse), kappa L chain}
evqlqqsgaelmkpgasvkisckasgytfsdywiewvkqrpghglewigeilpgsgstny
herfkgkatftadtssstaymqlnsltsedsgvyyclhgnydfdgwgqgttltvssakt

SCOP Domain Coordinates for d3hflh1:

Click to download the PDB-style file with coordinates for d3hflh1.
(The format of our PDB-style files is described here.)

Timeline for d3hflh1: