SCOP 1.59: Domain d3hflh1: 3hfl H:1-116

Lineage for d3hflh1 (3hfl H:1-116)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Fab HyHEL-5 (mouse), kappa L chain [48787] (3 PDB entries)

8. Domain d3hflh1: 3hfl H:1-116 [19969]
   Other proteins in same PDB: d3hflh2, d3hfll2, d3hfly_

Details for d3hflh1

PDB Entry: 3hfl, 2.65 Å

PDB Description: the refined structure of the monoclonal antibody hy(slash)hel-5 with its antigen hen egg white lysozyme

SCOP Domain Sequences for d3hflh1:

Sequence; same for both SEQRES and ATOM records:

>d3hflh1 b.1.1.1 (H:1-116) Immunoglobulin (variable domains of L and H chains) {Fab HyHEL-5 (mouse), kappa L chain}
evqlqqsgaelmkpgasvkisckasgytfsdywiewvkqrpghglewigeilpgsgstny
herfkgkatftadtssstaymqlnsltsedsgvyyclhgnydfdgwgqgttltvssakt

Timeline for d3hflh1:

• d3hflh1 first appeared (with stable ids) in SCOP 1.55
  
• d3hflh1 appears in SCOP 1.57
  
• d3hflh1 appears in SCOP 1.61
  
• d3hflh1 last appears in SCOP 1.71