Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.305: NAP-like [143112] (1 superfamily) core: central meander 4-stranded beta-sheet (order: 1234) transversed by a C-terminal helix |
Superfamily d.305.1: NAP-like [143113] (2 families) |
Family d.305.1.0: automated matches [196445] (1 protein) not a true family |
Protein automated matches [196446] (3 species) not a true protein |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [196447] (2 PDB entries) |
Domain d3kype_: 3kyp E: [199685] automated match to d3kypf_ |
PDB Entry: 3kyp (more details), 2.8 Å
SCOPe Domain Sequences for d3kype_:
Sequence, based on SEQRES records: (download)
>d3kype_ d.305.1.0 (E:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei whnplsyyl
>d3kype_ d.305.1.0 (E:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtkvvec trikwkegknpiawsifewfttdelqdkpdvgelirreiwhnplsyyl
Timeline for d3kype_: