SCOPe 2.06: Domain d3kype_: 3kyp E:

Lineage for d3kype_ (3kyp E:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.305: NAP-like [143112] (1 superfamily)
   core: central meander 4-stranded beta-sheet (order: 1234) transversed by a C-terminal helix

4. Superfamily d.305.1: NAP-like [143113] (2 families)

5. Family d.305.1.0: automated matches [196445] (1 protein)
   not a true family

6. Protein automated matches [196446] (3 species)
   not a true protein

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [196447] (2 PDB entries)

8. Domain d3kype_: 3kyp E: [199685]
   automated match to d3kypf_

Details for d3kype_

PDB Entry: 3kyp, 2.8 Å

PDB Description: crystal structure of nucleosome assembly protein s (pfnaps) from plasmodium falciparum

PDB Compounds: (E:) Nucleosome assembly protein

SCOPe Domain Sequences for d3kype_:

Sequence, based on SEQRES records:

>d3kype_ d.305.1.0 (E:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei
whnplsyyl

Sequence, based on observed residues (ATOM records):

>d3kype_ d.305.1.0 (E:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtkvvec
trikwkegknpiawsifewfttdelqdkpdvgelirreiwhnplsyyl

Timeline for d3kype_:

• d3kype_ first appeared in SCOPe 2.03
  
• d3kype_ appears in SCOPe 2.05
  
• d3kype_ does not appear in SCOPe 2.07