![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.305: NAP-like [143112] (1 superfamily) core: central meander 4-stranded beta-sheet (order: 1234) transversed by a C-terminal helix |
![]() | Superfamily d.305.1: NAP-like [143113] (2 families) ![]() |
![]() | Family d.305.1.0: automated matches [196445] (1 protein) not a true family |
![]() | Protein automated matches [196446] (1 species) not a true protein |
![]() | Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [196447] (1 PDB entry) |
![]() | Domain d3kypd_: 3kyp D: [199684] automated match to d3kypf_ |
PDB Entry: 3kyp (more details), 2.8 Å
SCOPe Domain Sequences for d3kypd_:
Sequence, based on SEQRES records: (download)
>d3kypd_ d.305.1.0 (D:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei whnplsyyl
>d3kypd_ d.305.1.0 (D:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvfdnkvv ectrikwkegknpiaifewfttdelqdkpdvgelirreiwhnplsyyl
Timeline for d3kypd_: