Lineage for d3hfll1 (3hfl L:1-106)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 547289Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 547704Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (19 PDB entries)
  8. 547712Domain d3hfll1: 3hfl L:1-106 [19968]
    Other proteins in same PDB: d3hflh1, d3hflh2, d3hfll2, d3hfly_
    part of Fab HyHEL-5

Details for d3hfll1

PDB Entry: 3hfl (more details), 2.65 Å

PDB Description: the refined structure of the monoclonal antibody hy(slash)hel-5 with its antigen hen egg white lysozyme

SCOP Domain Sequences for d3hfll1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hfll1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2}
divltqspaimsaspgekvtmtcsasssvnymywyqqksgtspkrwiydtsklasgvpvr
fsgsgsgtsysltissmetedaatyycqqwgrnptfgggtklei

SCOP Domain Coordinates for d3hfll1:

Click to download the PDB-style file with coordinates for d3hfll1.
(The format of our PDB-style files is described here.)

Timeline for d3hfll1: