![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
![]() | Species Fab HyHEL-5 (mouse), kappa L chain [48787] (3 PDB entries) |
![]() | Domain d3hfll1: 3hfl L:1-106 [19968] Other proteins in same PDB: d3hflh2, d3hfll2, d3hfly_ |
PDB Entry: 3hfl (more details), 2.65 Å
SCOP Domain Sequences for d3hfll1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hfll1 b.1.1.1 (L:1-106) Immunoglobulin (variable domains of L and H chains) {Fab HyHEL-5 (mouse), kappa L chain} divltqspaimsaspgekvtmtcsasssvnymywyqqksgtspkrwiydtsklasgvpvr fsgsgsgtsysltissmetedaatyycqqwgrnptfgggtklei
Timeline for d3hfll1: