SCOP 1.55: Domain d3hfll1: 3hfl L:1-106

Lineage for d3hfll1 (3hfl L:1-106)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab HyHEL-5 (mouse), kappa L chain [48787] (3 PDB entries)

8. Domain d3hfll1: 3hfl L:1-106 [19968]
   Other proteins in same PDB: d3hflh2, d3hfll2, d3hfly_

Details for d3hfll1

PDB Entry: 3hfl, 2.65 Å

PDB Description: the refined structure of the monoclonal antibody hy(slash)hel-5 with its antigen hen egg white lysozyme

SCOP Domain Sequences for d3hfll1:

Sequence; same for both SEQRES and ATOM records:

>d3hfll1 b.1.1.1 (L:1-106) Immunoglobulin (variable domains of L and H chains) {Fab HyHEL-5 (mouse), kappa L chain}
divltqspaimsaspgekvtmtcsasssvnymywyqqksgtspkrwiydtsklasgvpvr
fsgsgsgtsysltissmetedaatyycqqwgrnptfgggtklei

Timeline for d3hfll1:

• d3hfll1 appears in SCOP 1.57
  
• d3hfll1 last appears in SCOP 1.71