SCOPe 2.08: Domain d3ksma1: 3ksm A:39-313

Lineage for d3ksma1 (3ksm A:39-313)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (77 species)
   not a true protein

7. Species Hahella chejuensis [TaxId:349521] [196493] (1 PDB entry)

8. Domain d3ksma1: 3ksm A:39-313 [199679]
   Other proteins in same PDB: d3ksma2, d3ksmb2
   automated match to d3ksmb_
   complexed with bdr

Details for d3ksma1

PDB Entry: 3ksm, 1.9 Å

PDB Description: crystal structure of abc-type sugar transport system, periplasmic component from hahella chejuensis

PDB Compounds: (A:) ABC-type sugar transport system, periplasmic component

SCOPe Domain Sequences for d3ksma1:

Sequence; same for both SEQRES and ATOM records:

>d3ksma1 c.93.1.0 (A:39-313) automated matches {Hahella chejuensis [TaxId: 349521]}
pklllvlkgdsnaywrqvylgaqkaadeagvtllhrstkddgdiagqiqilsyhlsqapp
dalilapnsaedltpsvaqyrarnipvlvvdsdlagdahqglvatdnyaagqlaaralla
tldlskerniallrlragnastdqreqgfldvlrkhdkiriiaapyagddrgaarsemlr
llketptidglftpnesttigalvairqsgmskqfgfigfdqteeleaamyageisnlvv
qnpeymgylavqraldlvrgkpipaftdtgvrllq

Timeline for d3ksma1:

• d3ksma1 first appeared in SCOPe 2.03, called d3ksma_
  
• d3ksma1 appears in SCOPe 2.07