Lineage for d3ks6a1 (3ks6 A:1-249)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839880Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2839967Family c.1.18.0: automated matches [191539] (1 protein)
    not a true family
  6. 2839968Protein automated matches [190919] (11 species)
    not a true protein
  7. 2839969Species Agrobacterium tumefaciens [TaxId:176299] [196495] (2 PDB entries)
  8. 2839970Domain d3ks6a1: 3ks6 A:1-249 [199676]
    Other proteins in same PDB: d3ks6a2, d3ks6b2
    automated match to d3ks5b_
    complexed with act, cl, mg, peg, unl

Details for d3ks6a1

PDB Entry: 3ks6 (more details), 1.8 Å

PDB Description: crystal structure of putative glycerophosphoryl diester phosphodiesterase (17743486) from agrobacterium tumefaciens str. c58 (dupont) at 1.80 a resolution
PDB Compounds: (A:) Glycerophosphoryl diester phosphodiesterase

SCOPe Domain Sequences for d3ks6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ks6a1 c.1.18.0 (A:1-249) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
mtriashrggtlefgdstphgftataamaleevefdlhptadgaivvhhdptldattdmt
gaivdmtlakvktatirygagshpmtleelcalyvdshvnfrceikpgvdglpyegfval
viaglerhsmlerttfssfllasmdelwkattrprlwlvspsvlqqlgpgavietaiahs
iheigvhidtadaglmaqvqaagldfgcwaahtpsqitkaldlgvkvfttdrptlaialr
tehrmeasv

SCOPe Domain Coordinates for d3ks6a1:

Click to download the PDB-style file with coordinates for d3ks6a1.
(The format of our PDB-style files is described here.)

Timeline for d3ks6a1: