Lineage for d1jhll_ (1jhl L:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 220008Species Fv D11.15 (mouse), kappa L chain [48786] (1 PDB entry)
  8. 220010Domain d1jhll_: 1jhl L: [19966]
    Other proteins in same PDB: d1jhla_

Details for d1jhll_

PDB Entry: 1jhl (more details), 2.4 Å

PDB Description: three-dimensional structure of a heteroclitic antigen-antibody cross-reaction complex
PDB Compounds: (L:)

SCOP Domain Sequences for d1jhll_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jhll_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Fv D11.15 (mouse), kappa L chain}
dieltqspsylvaspgetitincrasksiskslawyqekpgktnnlliysgstlqsgips
rfsgsgsgtdftltisslepedfamyicqqhneypwtfgggtkleikr

SCOP Domain Coordinates for d1jhll_:

Click to download the PDB-style file with coordinates for d1jhll_.
(The format of our PDB-style files is described here.)

Timeline for d1jhll_: