SCOP 1.63: Domain d1jhll_: 1jhl L:

Lineage for d1jhll_ (1jhl L:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fv D11.15 (mouse), kappa L chain [48786] (1 PDB entry)

8. Domain d1jhll_: 1jhl L: [19966]
   Other proteins in same PDB: d1jhla_

Details for d1jhll_

PDB Entry: 1jhl, 2.4 Å

PDB Description: three-dimensional structure of a heteroclitic antigen-antibody cross-reaction complex

SCOP Domain Sequences for d1jhll_:

Sequence; same for both SEQRES and ATOM records:

>d1jhll_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Fv D11.15 (mouse), kappa L chain}
dieltqspsylvaspgetitincrasksiskslawyqekpgktnnlliysgstlqsgips
rfsgsgsgtdftltisslepedfamyicqqhneypwtfgggtkleikr

Timeline for d1jhll_:

• d1jhll_ first appeared (with stable ids) in SCOP 1.55
  
• d1jhll_ appears in SCOP 1.61
  
• d1jhll_ appears in SCOP 1.65
  
• d1jhll_ appears in the current release, SCOPe 2.08