Lineage for d3kpse1 (3kps E:3-118)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2354864Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2354892Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries)
  8. 2354923Domain d3kpse1: 3kps E:3-118 [199659]
    Other proteins in same PDB: d3kpsa1, d3kpsa2, d3kpsb_, d3kpsd2, d3kpse2
    automated match to d1mi5e1

Details for d3kpse1

PDB Entry: 3kps (more details), 2.7 Å

PDB Description: crystal structure of the lc13 tcr in complex with hla b*4405 bound to eeylqafty a self peptide from the abcd3 protein
PDB Compounds: (E:) LC13 TCR beta chain

SCOPe Domain Sequences for d3kpse1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kpse1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvsqsprykvakrgqdvalrcdpisghvslfwyqqalgqgpefltyfqneaqldksglps
drffaerpegsvstlkiqrtqqedsavylcasslgqayeqyfgpgtrltvte

SCOPe Domain Coordinates for d3kpse1:

Click to download the PDB-style file with coordinates for d3kpse1.
(The format of our PDB-style files is described here.)

Timeline for d3kpse1: