![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
![]() | Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (29 PDB entries) |
![]() | Domain d3kpse1: 3kps E:3-118 [199659] Other proteins in same PDB: d3kpsa1, d3kpsa2, d3kpsb_, d3kpsd2, d3kpse2 automated match to d1mi5e1 |
PDB Entry: 3kps (more details), 2.7 Å
SCOPe Domain Sequences for d3kpse1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kpse1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} gvsqsprykvakrgqdvalrcdpisghvslfwyqqalgqgpefltyfqneaqldksglps drffaerpegsvstlkiqrtqqedsavylcasslgqayeqyfgpgtrltvte
Timeline for d3kpse1: