Lineage for d3kpsa1 (3kps A:1-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2545007Species Human (Homo sapiens), HLA-BW44 [TaxId:9606] [102837] (19 PDB entries)
    Uniprot P30481 25-300
  8. 2545027Domain d3kpsa1: 3kps A:1-181 [199655]
    Other proteins in same PDB: d3kpsa2, d3kpsb_, d3kpsd1, d3kpsd2, d3kpse1, d3kpse2
    automated match to d1syva2

Details for d3kpsa1

PDB Entry: 3kps (more details), 2.7 Å

PDB Description: crystal structure of the lc13 tcr in complex with hla b*4405 bound to eeylqafty a self peptide from the abcd3 protein
PDB Compounds: (A:) HLA class I histocompatibility antigen, B-44 alpha chain

SCOPe Domain Sequences for d3kpsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kpsa1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-BW44 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfitvgyvddtlfvrfdsdatsprkeprapwieqegpeyw
dretqisktntqtyrenlrtalryynqseagshiiqrmygcdvgpdgrllrgydqyaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqdrayleglcveslrrylengketlq
r

SCOPe Domain Coordinates for d3kpsa1:

Click to download the PDB-style file with coordinates for d3kpsa1.
(The format of our PDB-style files is described here.)

Timeline for d3kpsa1: