Lineage for d1cicb1 (1cic B:1-117)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102109Species Anti-idiotope (D1.3) Fab E225, (mouse), kappa L chain [48785] (1 PDB entry)
  8. 102111Domain d1cicb1: 1cic B:1-117 [19965]
    Other proteins in same PDB: d1cica2, d1cicb2, d1cicc2, d1cicd2

Details for d1cicb1

PDB Entry: 1cic (more details), 2.5 Å

PDB Description: idiotope-anti-idiotope fab-fab complex; d1.3-e225

SCOP Domain Sequences for d1cicb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cicb1 b.1.1.1 (B:1-117) Immunoglobulin (variable domains of L and H chains) {Anti-idiotope (D1.3) Fab E225, (mouse), kappa L chain}
qvqlqqpgselvrpgasvklsckasgytftnywmhwvkqrpgqglewigniypgsgdsny
dekfkskatltvdtssstaymqlsgltsedsavyycarglafyfdhwgqgttltvss

SCOP Domain Coordinates for d1cicb1:

Click to download the PDB-style file with coordinates for d1cicb1.
(The format of our PDB-style files is described here.)

Timeline for d1cicb1: